...

Interleukin-7 (IL-7), Human

A crucial cytokine for the development of B and T cells is IL-7. A heterodimer of IL-7 and hepatocyte growth factor (HGF) acts as a pre-pro-B cell growth-stimulating factor. During the early stages of T cell development, IL-7 has been identified as a cofactor for the V(D)J rearrangement of the T cell receptor beta (TCRB). Intestinal mucosal lymphocytes may be regulated by IL-7, which is produced by intestinal epithelial and epithelial goblet cells. Studies using knockout mice revealed that this cytokine is crucial for the survival of lymphoid cells.

Sale!

IL-7 is an important cytokine for B and T cell development. IL-7 and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. IL-7 is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. IL-7 can be produced by intestinal epithelial and epithelial goblet cells and may serve as a regulatory factor for intestinal mucosal lymphocytes. Knockout mice studies suggested that this cytokine plays an essential role in lymphoid cell survival.

Expression System

Escherichia coli

Sequence

MDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH with polyhistidine tag at the C-terminus

Species

Human

Tag

polyhistidine tag at the C-terminus

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Activity

Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED₅₀ for this effect is <0.8 ng/mL. The specific activity of recombinant human IL-7 is > 7 x 10⁸ IU/mg.

Purity

>95% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation

The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution

It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 minutes to ensure sufficient re-dissolved.

SR109-0020 SR109-0100
20 ug | 100 ug
Ambient temperature
Lyophilized protein should be stored at -20°C. This product is stable for one year upon receipt, when handled and stored as instructed. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. Avoid repeated freeze/thaw cycles. Note Please use within one month after protein reconstitution.

R.U.O

Request A Quote For

Interleukin-7 (IL-7), Human

Seraphinite AcceleratorOptimized by Seraphinite Accelerator
Turns on site high speed to be attractive for people and search engines.