A crucial cytokine for the development of B and T cells is IL-7. A heterodimer of IL-7 and hepatocyte growth factor (HGF) acts as a pre-pro-B cell growth-stimulating factor. During the early stages of T cell development, IL-7 has been identified as a cofactor for the V(D)J rearrangement of the T cell receptor beta (TCRB). Intestinal mucosal lymphocytes may be regulated by IL-7, which is produced by intestinal epithelial and epithelial goblet cells. Studies using knockout mice revealed that this cytokine is crucial for the survival of lymphoid cells.
IL-7 is an important cytokine for B and T cell development. IL-7 and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. IL-7 is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. IL-7 can be produced by intestinal epithelial and epithelial goblet cells and may serve as a regulatory factor for intestinal mucosal lymphocytes. Knockout mice studies suggested that this cytokine plays an essential role in lymphoid cell survival.
Expression System
Escherichia coli
Sequence
MDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH with polyhistidine tag at the C-terminus
Species
Human
Tag
polyhistidine tag at the C-terminus
Endotoxin Level
<0.1 EU per 1 μg of the protein by the LAL method.
Activity
Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED₅₀ for this effect is <0.8 ng/mL. The specific activity of recombinant human IL-7 is > 7 x 10⁸ IU/mg.
Purity
>95% as determined by SDS-PAGE. Ni-NTA chromatography
Formulation
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.
Reconstitution
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 minutes to ensure sufficient re-dissolved.
FRIX Biotech Pty Ltd offers a wide range of premium reagents, consumables and equipments. Our products are designed to deliver consistent results, enabling researchers to advance their studies with accuracy and confidence.
Copyright © 2025 Frix Biotech. All rights reserved.