...

Interleukin-4 (IL-4), Human

The IL-4 receptor also binds to IL-13, which may contribute many overlapping functions of IL-4 and IL-13. STAT6, a signal transducer and activator of transcription, is important in mediating the immune regulatory signal of this cytokine. This gene, IL-3, IL-5, IL-13, and CSF2 form a cytokine gene cluster on chromosome 5q. IL-4, IL-13 and IL-5 are found to be regulated coordinately by several long-range regulatory elements in an over 120 kilobase range on the chromosome.

Sale!

IL-4 is a pleiotropic cytokine produced by activated T cells. The IL-4 receptor also binds to IL-13, which may contribute many overlapping functions of IL-4 and IL-13. STAT6, a signal transducer and activator of transcription, is important in mediating the immune regulatory signal of this cytokine. This gene, IL-3, IL-5, IL-13, and CSF2 form a cytokine gene cluster on chromosome 5q. IL-4, IL-13 and IL-5 are found to be regulated coordinately by several long-range regulatory elements in an over 120 kilobase range on the chromosome. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

Expression System

Escherichia coli

Sequence

MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS with polyhistidine tag at the C-terminus

Species

Human

Tag

polyhistidine tag at the C-terminus

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Activity

Measure by its ability to induce TF-1 cells proliferation.

The ED50 for this effect is <0.2 ng/mL.

The specific activity of recombinant human IL-4 is approximately >2.8 x 10⁷ IU/mg.

Purity

>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation

The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution

It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 minutes to ensure sufficient re-dissolved.

SR106-0020 ,SR106-0100
20 ug | 100 ug
Ambient temperature
Lyophilized protein should be stored at -20°C. This product is stable for one year upon receipt, when handled and stored as instructed. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. Avoid repeated freeze/thaw cycles. Note Please use within one month after protein reconstitution.

R.U.O

Request A Quote For

Interleukin-4 (IL-4), Human

Seraphinite AcceleratorOptimized by Seraphinite Accelerator
Turns on site high speed to be attractive for people and search engines.