The IL-4 receptor also binds to IL-13, which may contribute many overlapping functions of IL-4 and IL-13. STAT6, a signal transducer and activator of transcription, is important in mediating the immune regulatory signal of this cytokine. This gene, IL-3, IL-5, IL-13, and CSF2 form a cytokine gene cluster on chromosome 5q. IL-4, IL-13 and IL-5 are found to be regulated coordinately by several long-range regulatory elements in an over 120 kilobase range on the chromosome.
IL-4 is a pleiotropic cytokine produced by activated T cells. The IL-4 receptor also binds to IL-13, which may contribute many overlapping functions of IL-4 and IL-13. STAT6, a signal transducer and activator of transcription, is important in mediating the immune regulatory signal of this cytokine. This gene, IL-3, IL-5, IL-13, and CSF2 form a cytokine gene cluster on chromosome 5q. IL-4, IL-13 and IL-5 are found to be regulated coordinately by several long-range regulatory elements in an over 120 kilobase range on the chromosome. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Expression System
Escherichia coli
Sequence
MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS with polyhistidine tag at the C-terminus
Species
Human
Tag
polyhistidine tag at the C-terminus
Endotoxin Level
<0.1 EU per 1 μg of the protein by the LAL method.
Activity
Measure by its ability to induce TF-1 cells proliferation.
The ED50 for this effect is <0.2 ng/mL.
The specific activity of recombinant human IL-4 is approximately >2.8 x 10⁷ IU/mg.
Purity
>98% as determined by SDS-PAGE. Ni-NTA chromatography
Formulation
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.
Reconstitution
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 minutes to ensure sufficient re-dissolved.
FRIX Biotech Pty Ltd offers a wide range of premium reagents, consumables and equipments. Our products are designed to deliver consistent results, enabling researchers to advance their studies with accuracy and confidence.
Copyright © 2025 Frix Biotech. All rights reserved.