...

Interleukin-6 (IL-6), Human

Il-6 is a cytokine with a wide variety of biological functions: it plays an essential role in the final differentiation of b-cells into ig-secreting cells, it induces myeloma and plasmacytoma growth, it induces nerve cells differentiation, in hepatocytes it induces acute phase reactants.

100 in stock

100 in stock

Il-6 is a cytokine with a wide variety of biological functions: it plays an essential role in the final differentiation of b-cells into ig-secreting cells, it induces myeloma and plasmacytoma growth, it induces nerve cells differentiation, in hepatocytes it induces acute phase reactants.

Expression System
Escherichia coli

Sequence
MVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM with polyhistidine tag at the C-terminus.

Species
Human

Tag
polyhistidine tag at the C-terminus

Endotoxin Level
<0.1 EU per 1 μg of the protein by the LAL method. Activity Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant human IL-6 is approximately >5 x 10⁸ IU/mg.
Measure by its ability to induce proliferation in MCF-7 cells.
The ED50 for this effect is <4.4 ng/mL. Purity >98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution
Unopened ampoules can be stored at -20°C or -80°C.
Need not spin the ampoule. Open the cap carefully, then dissolve the lyophilized protein with sterile water for a 100 μg/mL concentration or according to the product’s Certificate of Analysis (CoA). Rinse the inner side of the ampoule gently and stand for at least 20 minutes at room temperature. (Important Note: Do Not Vortex!) Use the reconstituted solution immediately or store it by distributing it to aliquots and store at -20 °C. (Avoid repeated freeze-thaw cycles) We recommend diluting the solution to working concentration by using buffers or medium containing a carrier*. (Do not dilute the working solution with water, which may cause protein degradation.)
*Carriers: 0.1% BSA or 5% HSA or 10% FBS.

SR108-0100
100 ug
Ambient temperature
Lyophilized protein should be stored at -20°C. This product is stable for one year upon receipt, when handled and stored as instructed. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

R.U.O

Request A Quote For

Interleukin-6 (IL-6), Human

Seraphinite AcceleratorOptimized by Seraphinite Accelerator
Turns on site high speed to be attractive for people and search engines.