IL-1 Beta proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin from synovial cells.
Interleukin-1 Beta (IL-1 Beta) is produced by activated macrophages, IL-1 Beta stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 Beta proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin from synovial cells.
Expression System
Escherichia coli
Sequence
MASAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS with polyhistidine tag at the C-terminus.
Species
Human
Tag
polyhistidine tag at the C-terminus
Endotoxin Level
<0.1 EU per 1 μg of the protein by the LAL method.
Activity
Measure by its ability to induce proliferation in D10.G4.1 cells.
The ED50 for this effect is <10 pg/mL.
The specific activity of recombinant human IL-1 beta is approximately >1.5 x 10⁸ IU/mg.
Measure by its ability to induce IL-8 secretion in HT29 cells.
The ED50 for this effect is 1.8-5.1 ng/mL.
Purity
>98% as determined by SDS-PAGE. Ni-NTA chromatography
Formulation
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.
Reconstitution
Unopened ampoules can be stored at -20°C or -80°C.
Need not spin the ampoule. Open the cap carefully, then dissolve the lyophilized protein with sterile water for a 100 μg/mL concentration or according to the product’s Certificate of Analysis (CoA). Rinse the inner side of the ampoule gently and stand for at least 20 minutes at room temperature. (Important Note: Do Not Vortex!)
Use the reconstituted solution immediately or store it by distributing it to aliquots and store at -20 °C. (Avoid repeated freeze-thaw cycles) We recommend diluting the solution to working concentration by using buffers or medium containing a carrier*. (Do not dilute the working solution with water, which may cause protein degradation.)
*Carriers: 0.1% BSA or 5% HSA or 10% FBS.elease of prostaglandin from synovial cells.
FRIX Biotech Pty Ltd offers a wide range of premium reagents, consumables and equipments. Our products are designed to deliver consistent results, enabling researchers to advance their studies with accuracy and confidence.
Copyright © 2025 Frix Biotech. All rights reserved.